SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6TTZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6TTZ3
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily FlgN-like 0.0000000000000111
Family FlgN-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F6TTZ3
Sequence length 140
Comment (tr|A0A0F6TTZ3|A0A0F6TTZ3_CITAM) Flagellar biosynthesis protein FlgN {ECO:0000313|EMBL:AKE58597.1} KW=Complete proteome OX=1261127 OS=Citrobacter amalonaticus Y19. GN=F384_05300 OC=Enterobacteriaceae; Citrobacter.
Sequence
MTRLSEILDQMTAVLNDLKTVMDAEQQQLSVGHINGSQLQRITEEKSSLLATLDYLEQQR
RLEQDPQRSANDDVAERWKAITDKTQHLRDLNQHNGWLLEDQIQRNQHALEVLKPYQEPS
LYGANGQPSSASRGGKKFSI
Download sequence
Identical sequences A0A0F6TTZ3
WP_046478969.1.51150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]