SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F6W1B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6W1B3
Domain Number 1 Region: 131-311
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.02e-33
Family Methylesterase CheB, C-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 3-103
Classification Level Classification E-value
Superfamily CheY-like 0.00000000000000384
Family CheY-related 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F6W1B3
Sequence length 314
Comment (tr|A0A0F6W1B3|A0A0F6W1B3_9DELT) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=927083 OS=Sandaracinus amylolyticus. GN=DB32_001901 OC=Sorangiineae; Sandaracinaceae; Sandaracinus.
Sequence
MTLRVCVVDDSDIAAQRIARILESDDDVRVIKRFASVDELRAWGDLDTASVVVLDVWMPG
ASGLGAIREIAARVPVVVVSDVAEGSDVALEAVAQGAVAFVSKRELGTEPGETRLRAIVR
DAATQSIARELPVLVIAGSTGAPRALERLVPGLRDVPAAIVVVQHLPLGGEVGFARWIAG
LGLPARPARHGDALASGRALIAPAGRHLVIENGVVRLVAGAIGELHVPSADRALASAASL
GRRVVALVLSGMGRDGARGIALALEGSATCLALSPDECAAPSMPRHALDVSPRVRAVRLD
TIVTDVREALRRRR
Download sequence
Identical sequences A0A0F6W1B3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]