SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F6WH08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F6WH08
Domain Number 1 Region: 2-283
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 2.75e-123
Family Bacterial photosystem II reaction centre, L and M subunits 0.000000000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F6WH08
Sequence length 283
Comment (tr|A0A0F6WH08|A0A0F6WH08_9STRA) Photosystem II protein D1 {ECO:0000256|RuleBase:RU004332} OX=3005 OS=Rhizosolenia setigera. GN=psbA OC=Rhizosoleniophycidae; Rhizosoleniales; Rhizosoleniaceae; Rhizosolenia.
Sequence
LLTATSCYIIAFIAAPPVDIDGIREPVAGSLLYGNNIISGAVIPSSNAIGMHFYPIWEAA
SIDEWLYNGGPYQLIVLHFLLGVASYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLV
YPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVT
SSLIRETTENESTNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLALWPV
LGIWLTAMGVSTMAFNLNGFNFNQSVVDSQGRVINTWADIINR
Download sequence
Identical sequences A0A0F6WH08

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]