SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7CZA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7CZA9
Domain Number 1 Region: 104-122,152-289
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 8.89e-30
Family PsbP-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F7CZA9
Sequence length 290
Comment (tr|A0A0F7CZA9|A0A0F7CZA9_9ROSI) Photosystem II reaction center PsbP family protein {ECO:0000313|EMBL:AKG63549.1} OX=337364 OS=Erodium chrysanthum. GN=PPD7 OC=Pentapetalae; rosids; malvids; Geraniales; Geraniaceae; Erodium.
Sequence
MAVMQHHHYFHGCKSVSFHRIYMSKPPDGRKDQSFQEATARPPAAQFAPLPSRFERRFLL
GIGSASLVAVGANFAGITSLLLGFSPRTGRDLKLDVLYPIGGYSRCIDPNEGFEFIYPVN
WVGDQTLLYRAAGKAESQRSLDLPPLNGSRSVDRRRNVNEPVVAFGPPGSSGELNVSVIV
SPISRDFSIEAFGGPRDVGEALVRTITGSSKRPNVEGTLIESTLREDPVKMVKYYEMEFR
VESPTFQRHNIAVCCVCNGRLYTLNAQAPESSWSKVKSDMHVIASSFSLT
Download sequence
Identical sequences A0A0F7CZA9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]