SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7GZS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7GZS4
Domain Number 1 Region: 89-256
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 2.14e-54
Family PsbP-like 0.000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F7GZS4
Sequence length 257
Comment (tr|A0A0F7GZS4|A0A0F7GZS4_9ROSI) Photosystem II subunit P-1 {ECO:0000313|EMBL:AKG63512.1} OX=158603 OS=Pelargonium transvaalense. GN=PSBP-1 OC=Pentapetalae; rosids; malvids; Geraniales; Geraniaceae; Pelargonium.
Sequence
MASTATCFLHHGHALASPSRSRHLVPAAKPNQMLCKAQKQDHDTAAVSRRLALTALIGTA
AVGSKVAPADAAYGEAANVFGKPKTNTDFLPYVGEGFKLIIPAKWNPSKEVEFPGQVLRY
EDNFDVTSNVTVTVTPTDKKSITDYGSPEDFLTKVDYLLGKQAYFGSTDSEGGFDSGSVA
TANVLDTATPVVGGKQYYYVSVLTRTADGDEGGKHQIVTATVSDGKLYMCKAQAGDKRWF
KGAKKFVESTANSFSVA
Download sequence
Identical sequences A0A0F7GZS4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]