SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7KIG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7KIG8
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.0000000000759
Family N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7KIG8
Sequence length 180
Comment (tr|A0A0F7KIG8|A0A0F7KIG8_9PROT) Uncharacterized protein {ECO:0000313|EMBL:AKH38903.1} KW=Complete proteome; Reference proteome OX=44574 OS=Nitrosomonas communis. GN=AAW31_15615 OC=Nitrosomonadaceae; Nitrosomonas.
Sequence
MKNKMSELMDGELEPVDADEVITELKKKHDLLNDWETYHMIGEALRQPAVSFHINVASRV
SERLIIEPTLFMPRVSQAHKRKFVTLSAAASCAALVSGWLVMQIADVQQEVLVTEKVNNK
AVVQVDHPVAFQPSPAFSLPFTLHHPGDYSLIHRELSPHTKMQAPITGVHQVESREEKSR
Download sequence
Identical sequences A0A0F7KIG8
WP_046850937.1.39488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]