SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7LR95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7LR95
Domain Number 1 Region: 4-57
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 2.55e-16
Family H-NS histone-like proteins 0.00025
Further Details:      
 
Domain Number 2 Region: 92-134
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000000000133
Family H-NS histone-like proteins 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F7LR95
Sequence length 134
Comment (tr|A0A0F7LR95|A0A0F7LR95_PHOTE) DNA-binding protein {ECO:0000256|PIRNR:PIRNR002096} KW=Complete proteome OX=230089 OS=Photorhabdus temperata subsp. thracensis. GN=VY86_18945 OC=Morganellaceae; Photorhabdus.
Sequence
MSDLKTLNNIRTLRAQARECELEFLEEILEKLTVAVEERREEESQVKAELEERSRKLEEV
RKMILEQGIDPSELLQTMSAGKSAGKTKRPARPAKYQYVDTNGETKTWTGQGRTPAVIKK
AIEDEGKTLESFLL
Download sequence
Identical sequences A0A081S1D0 A0A0F7LR95 T0NX23 U7QVX8
WP_021325507.1.101547 WP_021325507.1.12641 WP_021325507.1.65573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]