SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7M1L6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7M1L6
Domain Number 1 Region: 33-143
Classification Level Classification E-value
Superfamily DsrEFH-like 0.000000000451
Family DsrEF-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7M1L6
Sequence length 160
Comment (tr|A0A0F7M1L6|A0A0F7M1L6_9GAMM) MSMEG_0572 family protein {ECO:0000313|EMBL:AKH68941.1} KW=Complete proteome; Reference proteome OX=1620392 OS=Spongiibacter sp. IMCC21906. GN=IMCC21906_01263 OC=Spongiibacteraceae; Spongiibacter.
Sequence
MPTVETAHYKDGDFLVDYEEKVFEDVQAAPGAKALITFHTVAFEGSIGLVNLLQAKRLLR
KGFETKVLLYGPGVQLGVQRGFPTLGAEAFPGHLACNNQLKAFMEEGGEVYACRFALQAL
YGQTEKALIEGIRPINPLDVMDLQLLMARDNAFMVHTWTT
Download sequence
Identical sequences A0A0F7M1L6
WP_047011439.1.7831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]