SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F7PCP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7PCP5
Domain Number 1 Region: 220-485
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.61e-55
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.073
Further Details:      
 
Domain Number 2 Region: 9-244
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.1e-30
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0077
Further Details:      
 
Domain Number 3 Region: 502-610
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.61e-17
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F7PCP5
Sequence length 630
Comment (tr|A0A0F7PCP5|A0A0F7PCP5_9EURY) 2-ketoglutarate ferredoxin oxidoreductase subunit alpha {ECO:0000313|EMBL:AKH97950.1} KW=Complete proteome; Reference proteome OX=1604004 OS=Halanaeroarchaeum sulfurireducens. GN=HLASF_1469 OC=Halobacteriaceae; Halanaeroarchaeum.
Sequence
MTTDELIWRISGGSGDGVDSTSQNFTKALMRSGLHVFTHRHYPSRIRGGHTYVEVRASAE
PVASRGDGFNVLLTLGDSFARNTDEDAVYGNEAIKPLSENLDELRDGGIIVFDSGQVDIE
EVPNFEERAEEHDWQVFPVDLRGIAKEHGREIMRNTAGVGATAALIDMDLDPVEDLMAEA
MSGDILEANLDVLEDAHDHVTEEFDTDTGLSVPQGEHDEEQVLLSGSHGISYGAIDEGCR
FISGYPMTPWTDVFTIMSQELEEMGGIAEQVEDEIAAAAAAIGASHAGAKAMSGSSGGGF
ALMSEPLGLAEMTETPLVLVESMRAGPSTGMPTKTEQADLEHVLYTSQGDHSRLAFAPGD
PVEAYEQTRKAFELAWKYQMPAIVIYDSKLAGEYRSVPKSAFDQEPNPDLGSTLTEDELA
DAPHDDTGRFQRFQHDVEDDVSPRSLPGQENGRFLATGNEHWPNGQIAEDTTNRVNQVDR
RLGKLSSVRDDLNAMEESFQSHWGTEDAEIGVLTWGSTQDSVEEAVENLAATGRPVAGLG
VSEIAPFPEAEIVEFVESVDEVMIVEMNASAQFRGLLQKELGAYGQKISSLLKYNGEPFR
AGEIEEAIEIELNGGGEPTAQVTLRPATGD
Download sequence
Identical sequences A0A0F7PCP5
WP_050048658.1.47078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]