SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F7PLJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7PLJ4
Domain Number 1 Region: 26-219
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000000248
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F7PLJ4
Sequence length 527
Comment (tr|A0A0F7PLJ4|A0A0F7PLJ4_9RHIZ) 2-oxoacid:ferredoxin oxidoreductase, gamma subunit {ECO:0000313|EMBL:AKI00099.1} KW=Complete proteome; Reference proteome OX=1620421 OS=Hoeflea sp. IMCC20628. GN=IMCC20628_01382 OC=Phyllobacteriaceae; Hoeflea.
Sequence
MALNIASEFTPKRQDPALDQIIKLAVMAVGGQGGGVLTNWIEDCAHRNGYVVQATSVAGV
AQRTGATIYYMEMAPAQERNPVFSLMPAAGDVDILVAAEMMEAGRAIMRGFVTPDRTTLI
ASSHRALAVSEKMVPGDGIADSEEVIATAEIASQRFIAFDMEKMAVDAGSMISASLFGAL
AGSGALPFERESFEAAIRASGRGVEASLRAFAAGFEAAAGGIVERPSSGKTKLAVANTPA
GPTRLVEKWNALEARAMALPASARDMALTGLRAVVDFQDLDYGSEYLDRVETVLAQDDAS
KDHELTFEAAKYIAKAMAYDDVFRVADLKTRGSRFARIQTEMKPAKGAQMKLTEFMHPRA
EEIVGMMPSRLGRRLSASQSVMRLIDKLFNRGRRLRTDRLLPFAQLYVLGGLRKYRRGTL
RHSIEKQHMEHWLELVMTYRKIDYALAVETLRNRRLVKGYSDTHTRGLSKFDRVMNGVAL
LAGRDDAAHWCRLLREAALADEKGDQLEGALKTVRSFAEQSETGHQA
Download sequence
Identical sequences A0A0F7PLJ4
WP_047029589.1.77775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]