SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F7TM02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7TM02
Domain Number 1 Region: 336-535
Classification Level Classification E-value
Superfamily MIR domain 1.24e-56
Family MIR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F7TM02
Sequence length 934
Comment (tr|A0A0F7TM02|A0A0F7TM02_9EURO) Uncharacterized protein {ECO:0000313|EMBL:CEJ56926.1} KW=Complete proteome; Reference proteome OX=104259 OS=Penicillium brasilianum. GN=PMG11_05638 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MGQKSKDTLAVRPQSRGRRSRSRSPNPKGAKPAKIASYASDGVRDNDILNLPASDYKLLV
LVTLIAAAVRLFRIYQPSSVVFDEVHFGGFASKYIKGKFFMDVHPPLAKLLITLAGWLAG
FDGNFDFKDIGKDYIEPGVPYVAMRMLPAILGVLTVSLMFLTLKATGCRTSTAVMGAGLV
IFDNALTTQSRLILLDSPLIFFTALTALTFSCFTNQQELGPAAAFKGAWWFWLAATGVSL
GATLSVKWVGLFTMAWVGSLTVLQLWVVLGDSKTVTPRLWFKHFFSRVFCLIVIPLGFYM
AMFGIHFLCLVNPGEGDGFMSSEFQATLNSKSMQDVPADVSFGSRVSIRHHNTQGGYLHS
HNHMYPTGSKQQQITLYPHKDENNVFIMENQTQPLGPYGEIEGPFAWDNSSVSFIEDGAV
VRLYHELTHRRVHSHDERPPVTEADWQFEVSAYGYEGFPGDANDLFKIEIVKSLSEGAEA
KKRVRTIQTKFKLVHVMTGCVLFSHKVKLPEWGFEQQEVTCARGGTLPNSIWYIESNTHP
MMPADAEKVNYRNPGFLGKFWELQKVMWTTNAGLVESHAWDSRPPSWPTLLRGINFWGKD
NRQIYLLGNPLIWWSSTAAIGIYFLFKAIAVIRWQRSCNDYRHISFKRFDYEVGTSVLGW
FFHYFPFFLMARQLFLHHYLPALYFAIMVLCQEFDFITNRIKSLGLASRPAIGKVLMAGF
LILSIAVFTLYTPLIYGNPWTQSACQKVKLLDGWDFDCNTFHTDLSQYVTDVDNFMKIVP
TEQAQIHNLGDHQQQEQAPAAEISQQQQPEDQAAVTQPKLSGSVARVEYRDQHGNVLPED
VVASLRAEGKVKFETRYESRSKLEHAQEIPIVDGQLAPPHPDVEGQNPETGSGKPEDSVP
PETPASVAEGNVRSVESSESPEAKPASEGFEATK
Download sequence
Identical sequences A0A0F7TM02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]