SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F7U5W3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7U5W3
Domain Number 1 Region: 136-243
Classification Level Classification E-value
Superfamily MIR domain 0.00000497
Family MIR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7U5W3
Sequence length 312
Comment (tr|A0A0F7U5W3|A0A0F7U5W3_9EURO) Uncharacterized protein {ECO:0000313|EMBL:CEJ62872.1} KW=Complete proteome; Reference proteome OX=104259 OS=Penicillium brasilianum. GN=PMG11_11357 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MRFLYRIPLAALLVAGALFLVSAFVFPVSETSYAGNYHLRHLSAAARREMRSQISPLSKT
DYKEETGLENTSLQFALRPGTIVSIYLPHAGFLWSDFNAWDEEHAIFYPLDMSSSSLEAA
TWRVVFKDPIGRMKPWVIQRPVTSYSPSGTISPVLHGDRILLRDAELDGFLTAEAQPSIL
DRLFLGGDPTTGRHEVNVQAVPGNGSLWTIKYNPATDCGFRLYNPERSCYLSSSLRNFPD
WDGALNDTIAALLHLELEATCMAEPKDAVSRLFLVDGNSILTGKILRSIICLRSIIETAR
KSLNITRNCWGS
Download sequence
Identical sequences A0A0F7U5W3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]