SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F7WY08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7WY08
Domain Number 1 Region: 358-396
Classification Level Classification E-value
Superfamily MIR domain 0.0000301
Family MIR domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F7WY08
Sequence length 418
Comment (tr|A0A0F7WY08|A0A0F7WY08_CHLPN) MAC/perforin family protein {ECO:0000313|EMBL:CRI42303.1} OX=83558 OS=Chlamydia pneumoniae (Chlamydophila pneumoniae). GN=BN1224_DC9_AY_00010 OC=Chlamydia/Chlamydophila group; Chlamydia.
Sequence
SEEDDDPMDESDGEEASKDSAFSASFSYEFVKSSTRESKNTVTHSTASRTLYILRQDCSY
DPRALKVDDEFRYWVEKRLDAKNPDSLNAFVKEVGTHYVTSVTYGGIGFQVLKMSYLQVE
ELEKEKISISVAAASSLLKSKTSNATEKGYSSYQSESSAQTVFLGGTVLPDLQQDKLDFK
DWSESVPNEPIPLAISVSSITDLIIPELFPSEDAQVLSQKKSALGKVILNYLESHKPKEE
GPKPVQITSGFNSSSSVFTLQAAKAPKTVSFPYIDYWSTIPYLFPTLKETSGAQPLSFYL
RFDDIFEQQNLVHNTSYILASTSVRLGYFGDSYRDYDALSFYGSWPQAYFDWAGYKDRCT
WTLEKLNTTGDLFIRSGDEIRLKHNTSGKYLATTSMSDGYQTLTCTTQTSDSVFIITV
Download sequence
Identical sequences A0A0F7WY08

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]