SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F7Y4T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7Y4T9
Domain Number 1 Region: 4-186
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.24e-58
Family Methylesterase CheB, C-terminal domain 0.0000985
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7Y4T9
Sequence length 191
Comment (tr|A0A0F7Y4T9|A0A0F7Y4T9_9PSED) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=1649877 OS=Pseudomonas sp. CCOS 191. GN=CCOS191_2207 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNSVRAIVIGASAGGVSALFSVLGALPDDFAIPVLCVLHLPDDRHSQLAEVLQRRLRRPV
REALDKARIEPGLIYVAGPGYHLSVERDFTLSLSQEEPVHFSRPAIDFLFESAADAYGPE
LLGVLLTGANEDGARGLLRIRQSGGRTVVQDPREAQVALMPEAALALHDPDHILSLSGIG
QLLATLEPSAC
Download sequence
Identical sequences A0A0F7Y4T9
WP_046855252.1.83237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]