SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F7Y7U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7Y7U9
Domain Number 1 Region: 268-349
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase, C-terminal domain 2.49e-30
Family Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.0000282
Further Details:      
 
Domain Number 2 Region: 6-77
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 3.92e-28
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00014
Further Details:      
 
Domain Number 3 Region: 188-266
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase domain 1.71e-21
Family Methylated DNA-protein cysteine methyltransferase domain 0.00036
Further Details:      
 
Domain Number 4 Region: 84-131
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000236
Family AraC type transcriptional activator 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F7Y7U9
Sequence length 352
Comment (tr|A0A0F7Y7U9|A0A0F7Y7U9_9PSED) Bifunctional transcriptional activator/DNA repair enzyme Ada {ECO:0000313|EMBL:CRI59139.1} KW=Complete proteome OX=1649877 OS=Pseudomonas sp. CCOS 191. GN=CCOS191_4603 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTPAPTTYTTDAERWHAVQSRDTAATGHFVYAVRTTGVYCQPACKSRLAKRENVEFFADP
GQAEAAGYRACKRCKAGQGSRRTDLVARACRLIEASETAPNLDQLGSELNVSPFHLHRLF
KAETGLTPKAYASAFRAQRLRQRLDAADSVTEAIYDAGYNSNSRFYESAAERLGMRPREY
RAGGQGATIHFAVAQCSLGAILVAQSERGICAILLGDEPEPLLKDLQDKFPKARLIGGDD
AFERLVAEVIGFVEAPALGLALPLDVQGTAFQERVWQALREVPPGTTVSYTDIAERIGAP
KAVRAVAQACAANTIAVAIPCHRVVRRDGDLSGYRWGIERKRQLLDRETALS
Download sequence
Identical sequences A0A0F7Y7U9
WP_046857164.1.83237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]