SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F7ZCT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7ZCT1
Domain Number 1 Region: 8-231
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-86
Family Capz alpha-1 subunit 0.00000000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7ZCT1
Sequence length 235
Comment (tr|A0A0F7ZCT1|A0A0F7ZCT1_CROAD) F-actin-capping protein subunit alpha-2-like protein {ECO:0000313|EMBL:JAI14491.1} OX=8729 OS=Crotalus adamanteus (Eastern diamondback rattlesnake). GN= OC=Toxicofera; Serpentes; Colubroidea; Viperidae; Crotalinae; Crotalus.
Sequence
MADQDDQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPAKIEGYDEQVLITEHGDLGNGKFLDPKNKIAFKFDHLRKEATDPKPHDVENAIESW
RNSIEIAMRAYVKEHYPNGVCTVYGKTIDGHQTIIVCIESHQFQAKNFWNGRWRSEWKFT
IMPSTTQVAGILKIQVHYYEDGNVQLVSHKDIQDSLTVTNEIQTAKEFVKMEMFS
Download sequence
Identical sequences A0A0F7ZCT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]