SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F7ZQE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F7ZQE1
Domain Number 1 Region: 334-520
Classification Level Classification E-value
Superfamily MIR domain 4.19e-61
Family MIR domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F7ZQE1
Sequence length 742
Comment (tr|A0A0F7ZQE1|A0A0F7ZQE1_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:KJZ77090.1} KW=Complete proteome; Reference proteome OX=1043627 OS=Hirsutella minnesotensis 3608. GN=HIM_03411 OC=Hirsutella.
Sequence
MAIDKAAAASGVDVGAGLRKRPVTDYATATTPPAIEIDDKKKLVKKEPSLIETLGQWEPI
LAPLIFTLLAFATRLWKIGLSNIVTWDEAHFGKFGSYYIKHEYYFDVHPPLGKMLVGLSG
VLAGYNGSFEFKSGEKYPEEVNYAFMRAFNALFGIVCIPLAYFTARELNLRRPAVWLVTL
MVLCENSYTTISRFILLDSMLLCGTVTTVFCWAKFHNQRHNSFEPEWFFWMFLTGLSIGC
VCSVKLVGLFVTALVGLYTVEDLWRKFGDTKMPLTTLGAHVVTRVVGLIVVPFLIYLLSF
ALHFAILDKTGPGDAQMSSLFQANLKGTEVGRDSPLEIALGSRATLKNMGYGGGLLHSHV
QTYPEGSQQQQVTCYHHKDANNDWFLYPNRGEPEYDNESTDMRFIGDGSVVRLIHAQTGR
NLHSHDISAPVTKADKEVSCYGNLTIGDHKDHWKIEVVRDAASRDRSRIRTLTTAFRLKH
TALGCYLRAGNTNLPQWGFRQIEVTCTKENKPRDTYTHWNVESHWNDKLPPGDPAVYKSP
FFHDFVHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHVGLRMCGWDDNIIKYFLLGN
PFIYWGTTAGLGLVGLIVFWYLLRWQRGMQDLNAKEIDQVHFSGLYPAAGWFLHYLPFVV
MARVTYVHHYYPALYFAILTSGFLVDWLVRNRSQAIQSVVYGTLYAVIIGLYILFIPICW
GMTGSNHQYSYLKWFDNWRISD
Download sequence
Identical sequences A0A0F7ZQE1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]