SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F8AZ59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8AZ59
Domain Number 1 Region: 183-360
Classification Level Classification E-value
Superfamily MIR domain 1.7e-47
Family MIR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 1042-1134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-16
Family SPRY domain 0.074
Further Details:      
 
Domain Number 3 Region: 611-766
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000475
Family SPRY domain 0.058
Further Details:      
 
Domain Number 4 Region: 401-512
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000235
Family IP3 receptor type 1 binding core, domain 2 0.017
Further Details:      
 
Domain Number 5 Region: 67-148
Classification Level Classification E-value
Superfamily MIR domain 0.0000497
Family MIR domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F8AZ59
Sequence length 1882
Comment (tr|A0A0F8AZ59|A0A0F8AZ59_LARCR) Ryanodine receptor 3 {ECO:0000313|EMBL:KKF17342.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_04692 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MAEGGEGEDEIQFLRTDDEVVLQCVACIQKENRKFCLAAEGLGNRLCYLEPTSEAKAAQS
GGHKTLLYGHAILLRHSFSSMYLACLKTSRSQTDKLSFDVGLQEDSTGEACWWTIHPASK
QRSEGEKVRIGDDLILVSLSSERYLHLSISNGNIQVDASFMQTLWNVHPICSGSNIEEGY
LLGGHVMRLFHGHDEVVAIPGSDQSEEQQRIVNYETGKAGAKARSLWRLEPLRISWSGSH
IRWGQPFRLRHLTTGHYLALTEDRGLVLQDRERSDTIATAFCFRASKEKLEQSPKRDIEG
MGVAEIKYGDSLCFIMHVATGLWLSYQAPDVKSARLGPLKRRACLHSEGHMDDGLTLQRC
QHEESRAARIIRNTTLLFNRFIRDLDCLGVKNRALVSLPVEEVLQTLNDLIAYFQLPDVE
LEHEERQIKLRSLKNRQNLFKQEGMLTLVSNCIDRLNVYNSAAHFGECAGSEAGAAWKDI
LNLLYELLAALIRGNRNNCTQFSNNLDWLVSKLERLESSSGILEVLHCILIESPEALNII
QRGHIKSIISLLYKHGRNHKILDVLCSLCVCNGVAVRTNQNLICDHLLPKRDLLLQTQLV
NDVQSMRPNIFLGVSEGSAQYKKWYYELMIDQVDHFVTSEPSHLRVGWANSKGYAPYPGG
GEGWGGNGVGDDLYSFGFDGLHLWSGRIPRAVASMNQHILTSEDVVSCCLDLGAPSISFR
INGQPVQGMFENFNTDGLFFPVVSFSAGVKVRFLLGGRHGDFKFLPPSSYAPCYEALLPK
EKMKVEQVKEYKRDVDGVRDLLGTAHFLSQASFIPTPVETSQIVMPPHLEKVRDKLAENI
HELWGMNKIELGWSYGKIRDDNKRQHPCLVDFSKLPETEKNYNLQMSTETLKTLLALGCR
VVQVNPNAESSLKKIKLPKNYMMSNSYKPSPLDLSDIKLTPGQELLVDKLAENAHNVWAK
DRIKQGWTYGIQQDLKSKRNPRLVPYVLLDERTKKSNRDSLREAIRTLIGYGYNIEPSDQ
EGGQVVERLSIDKVRFFRVERTYAVKTGKWYFEFEAVTGGDMRVGWARPGCKPDVELGTD
ELAFVFDGYRGHCLNMGSRLFGRCWHAGDVVGCMINMEDKSMIFTLNGEILITTKGSELC
FTDFETEDGFIPVCSLGLSQVGRMNLGKDASTFKYYTMCGLQEGFEPFAVNMNREVTMWF
SKRLPTFINVPKDHNHIAVTRIDGTIDSPPCLKVTHKTFGTQNSNADMVFCRLSMPVEFH
SIFKSSPVVDMNGVHEEDTLKVKHRYPLRSVRHSDESRRVDYSSITTYYHSVRVFAGQDP
AGVWVGWVTPDYHYYSNNFNLSKNRTVTVTLGDERGRVHESVRRSNCYMVWGGDVTNAAH
ASSRSNVDLEIGCVEPNTKLFPAVFVRPTSPNLFQFELAKIKNAMPLSSAIFKSEHKNPV
PQCPPRLDVQTISAVLWSRMPNTFLKVETARVNERHGWVVQCVEPLQMLAVHIPEENRCV
DIMELSEQKDMRKFHYHTLKLYCALCALGNTRVAHALCSHLDQSQLLYTIDNQYLSGMLR
EGFYNVLISTHLETAKEARLMMKDEFIIPVTAETRSIRLFSDASKKHLPPGVGLSTSLKP
RLNFAPPCFISTKREQHLYSPQIPLDALKEKSISMLTEAVQGGGHHIRDPVGGGVEYQFV
PILKLISTLLTMGVLGSEDVHQILLLIDPNVFRETREDGATGATDKEGLTGTEEKAVEAG
EEEAAKEAKQPLKGLLEKRLPEPVKRQMCELLHYFCDCELKHRIEAIVSFSDNFVSKLQF
NQKFRYNELMLALNMSAAVTAKKTKEFRSPPQEQINMLLTFSMGEDCPCPTDIQEELYDF
HNQLQLHCEKSQFSASNIALTT
Download sequence
Identical sequences A0A0F8AZ59

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]