SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8BBT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8BBT1
Domain Number 1 Region: 15-224
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.38e-57
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 237-279
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000157
Family SOCS box-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F8BBT1
Sequence length 280
Comment (tr|A0A0F8BBT1|A0A0F8BBT1_LARCR) Ankyrin repeat and SOCS box protein 13 {ECO:0000313|EMBL:KKF30655.1} KW=Complete proteome; Reference proteome OX=215358 OS=Larimichthys crocea (Large yellow croaker) (Pseudosciaena crocea). GN=EH28_11044 OC=Eupercaria; Sciaenidae; Larimichthys.
Sequence
MDIDNERPYFFGDIGCWSERTEVHKAASLGQASELQHLIQSGASVNMVAVDSITPLHEAC
LRGQAQCVRLLLDAGAQVDARNVDGSTPLCDACSSGSLECVSLLLEHGAKANPALTSRTA
SPLHEACMGGNADCVKLLIAMDACLEAYDLYYGTPLHVACANEHTSCVKVLLNAGAKVNA
ARLHETPLHHAAKNMRVEMIEILVEFGANIYARDQHNRKPVDYTTPGSPSAVCLQLYETT
PMSLQQLSRLAVRKKLGTRALKVMDQLHIPKLLISYLCYQ
Download sequence
Identical sequences A0A0F8BBT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]