SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8ED46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8ED46
Domain Number 1 Region: 4-49,79-137
Classification Level Classification E-value
Superfamily DsrEFH-like 6.87e-19
Family DsrEF-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F8ED46
Sequence length 139
Comment (tr|A0A0F8ED46|A0A0F8ED46_9EURY) NAD(FAD)-dependent dehydrogenase {ECO:0000313|EMBL:KKG12738.1} KW=Complete proteome OX=1483600 OS=Methanosarcina sp. 2.H.A.1B.4. GN=EO92_03245 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MGEKAVIVLHSGDMDKVYSALIIGNGALAMGMEASIYFTFWGLMRLKKGELEKGPLSKMN
MMGMGRQMIKKRMDKANVASLERLMNDFKELGGKIIACEMTMEIMGITKEELRTELVDEW
GAVGTYIQEARNANITLFI
Download sequence
Identical sequences A0A0F8ED46
WP_048168906.1.50979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]