SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F8ULB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8ULB9
Domain Number 1 Region: 1124-1359
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.01e-74
Family Capz beta-1 subunit 0.000000214
Further Details:      
 
Domain Number 2 Region: 345-492,643-792
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.4e-45
Family Tandem AAA-ATPase domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F8ULB9
Sequence length 1363
Comment (tr|A0A0F8ULB9|A0A0F8ULB9_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KKK20409.1} KW=Complete proteome; Reference proteome OX=308745 OS=Aspergillus rambellii. GN=ARAM_004591 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MSDPEDGSSDYLDDEMCDFIVHDAPSPRSAKRRRVSAREPVRESSRRKATDEEDSEDFGS
GADSFLDENEDDPSSPGQTSLYFRDDPDRESKSKYKVFIPKHNNLQENIFVTQLTQPPSP
PEMIRGPRWKKPGPNPSPPQVAAISPADRRVQYASQDHNYGDDDDLKAAIEASLQSFEEE
SSKIATVTSKNPTPSSVRAAPEEVDLFDDIPDDAFDSDLSLSPPPNPVAPSVPWATSQSR
NRPLGVRQTTLFDMAVRNSPNPPPRGEQLWSPPEKEEPPTQHKLNQDTMDTWIYPTNLGK
TRDYQFNIAQKGLFHNLLVALPTGLGKTFIAATIMLNWFRWTHDAQIIFVAPTKPLVAQQ
ITACLQIAGIPRSQTTMLTGEAAPGIRAEEWQTKRLFFMTPQTLTNDLKSGIADPKRIVL
LVVDEAHRATGGYAYVEVVKFLRRFNQSFRVLALTATPGSTVESVQAVIDGLDIARVEIR
TEQSLDIREYVHDRNTDIQTFQNSDEMILCMDLLTSTLQPLVDQLRNLNAYWGRDPMTLT
PYGLTKARQQWMLSDAGRSANFGLKGKVNAIFTVLASMAHGIDLLKYHGITPFYRHLLHF
QSNTDGQKGGKYQRQIVQDEHFKKLMNYLGPWTKNPEFIGHPKLEYLKQVVLNHFMDSGE
GGSVGPEQSHPATRVMIFVHFRDSAEEVTRVLKRYEPMIRPHVFVGQSSAKGSDGMGQKT
QLDIIQKFKKGTYNTIVATSIGEEGLDIGEVDLIVCYDSSASPIRMLQRMGRTGRKRAGN
IVLLLMQGKEEESYIKAKDNYEKMQQMIASGTRFTFHDDISPRILPSGVKPVPDKRQITI
PDENASGDLPEPKRKRGRAPKRPPKQFHMPDNVETGFTKASHLTGSSKKKTPEKKKVRIP
TPEPADVPSLEEVLLTAAQQKELEQHYQNIGGTSPQFIRYPRGDAFPQLQRIQRPTKLVR
HGSLTRRVIGALRRMNEVKPGYEDRFREVLARESNMSPEESLLSIQPESRAQPPEASISR
FTFTKPSSLKPKGAEDDDFFGSDSEPPSPGKLLAVLGKPQKPKPFQPPRRVSEGAKLGND
LDVHNPSSRSIFDYDSDESACHQFGAGTQHHNQDSLQNFETMADAQFDSALDLLRRLNPR
DTKQNLQAITCIVPDLTEDLLSSVDQPLEIRRCARTNRDYLLCDYNRDGDSYRSPWSNEF
DPPLDDGTVPSERVRKLEVAANDAFDVYRELYYEGGVGSVYFWDLDDGFAGVILLKNGVT
PGAKNSGEWDSIHVFEATDRARMSHYKLTSTVEVDLPVESDASHVANVGRLVEDMELKMR
NLLQEVYFGKAKDVVGELRSLASLSETNRDRATQQEMIRSLQR
Download sequence
Identical sequences A0A0F8ULB9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]