SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F8UYL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8UYL1
Domain Number 1 Region: 334-519
Classification Level Classification E-value
Superfamily MIR domain 2.09e-61
Family MIR domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F8UYL1
Sequence length 741
Comment (tr|A0A0F8UYL1|A0A0F8UYL1_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KKK24593.1} KW=Complete proteome OX=138278 OS=Aspergillus ochraceoroseus. GN=AOCH_002958 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MADLPTASTTGANFASDVRRRNVPHTEKPYNASDLAQSSDEKAKPKHTSVLSVLSSWEPI
IAPILFTLLSIFTRMYRIGRSNIVTWDEAHFGKFGSHYLKREFYFDVHPPLGKMLVGLSG
LLAGYNGSFEFKSGEQYPEDLNYTFMRVFNAAFGVVCVPLAYLTARELGFRRATIWLVTL
MVLFENSYATISRFILLDSMLLCFTFTTTFCWAKFHRLQHASFSLEWFTWLFLTGISIGC
VCSVKWVGLFCTAIVGLYTAEDLWNKFGDRKVTDVVLAKHFVARVIGLIIVPLLVYLFSF
YLHFLILENSGPGDAQMSSLFQANLKGTQVGKDSPLEVAFGSRVTLKNMGYGGGLLHSHV
QTYPEGSSQQQVTCYHHKDANNEWFIYPNRQAPEYDQNADLRFIGDGEVIRLIHGQTGRN
LHSHNIPAPITKSHYEVSCYGNMTVGDDKDHWKIEVVDDAASRDRSKIRTLTTAFRLRHP
VLGCYLRAGNTNLPQWGFKQIETTCVKENTPRDVYTHWNVETHVNDRLPPGDPGSYKSPF
FKDFVHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNVGLRMCSWDDNIIKYYLLGNP
VVYWGSTLSLFVFGFLTLWYLVRWQRGYNELSQADVDHIHYAGFYPVIGWVLHYLPFIMM
ARVTYVHHYYPALYYAILTFGFCIDWLTQTLNAKVRGAVYTVLYVLITGMFVYFRVIVFG
MEGSSQQWAHLNWLSGWRIAN
Download sequence
Identical sequences A0A0F8UYL1 A0A0F8XKR8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]