SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F8W3X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8W3X5
Domain Number 1 Region: 172-241
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 3.79e-24
Family C-terminal domain of RNA polymerase alpha subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 2-93
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 7.06e-20
Family Insert subdomain of RNA polymerase alpha subunit 0.00045
Further Details:      
 
Domain Number 3 Region: 86-147
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 0.00000000000000122
Family RNA polymerase alpha subunit dimerisation domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F8W3X5
Sequence length 256
Comment (tr|A0A0F8W3X5|A0A0F8W3X5_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:KKK51407.1} OX=412755 OS=marine sediment metagenome. GN=LCGC14_3115270 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
TLNIKNLNFKIEGSSEKTAIVKATGPKEITGADLQVDASLAVMNPDQHILTLDKGVEFEA
EIYVEKGVGYRVSENQEVSEKSVDVIALDSVFSPVTKANFMVEKARVGRSTDYDRLVLEV
WTNGSVTPVAAISYAASILKEHLDFFVFEREEEETEIVDQEDMASVDVLAMNPNLLKSVD
ELELSVRAHNCLKNAEIKNISDLVQRTEYDMLRTKNFGRKSLKEIKEILGTMGLSFGMRV
DPAALEELEEAADNEA
Download sequence
Identical sequences A0A0F8W3X5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]