SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F8WWH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8WWH6
Domain Number 1 Region: 18-203
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.75e-53
Family Methylesterase CheB, C-terminal domain 0.00032
Further Details:      
 
Domain Number 2 Region: 225-288
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000000523
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0065
Further Details:      
 
Domain Number 3 Region: 286-333
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000947
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F8WWH6
Sequence length 333
Comment (tr|A0A0F8WWH6|A0A0F8WWH6_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:KKK61232.1} OX=412755 OS=marine sediment metagenome. GN=LCGC14_3016390 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MQKETKKPEETETSVMEIYVVAIAASAGGLDAINDFFENVPLDTNLSFVLIQHLSPDYKS
MMPELLTKHTKLNVSKVINETVVKPNCVYTIPADKNITISGGKLFLQDRGKPKTLNLPAN
IFLKSLASDQKERSVAVILSGTGSDGTLGIESIKEQGGMVIAQDPQTAAFDSMPKSIIAT
GLTDFILPPSEMPNTIVNYVKHPYVKKTDSANSITEDPLRDVVPEILSYMYQRTNMDFRN
YKKATLIRRIDRRMGIKNILNRSQYFKFLQTNPNESTHLANDILIGVTGFFRDKDAFDVL
DKKVLFDLVQKKETGKELRVWVAGCSTGQEVYS
Download sequence
Identical sequences A0A0F8WWH6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]