SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F8XZ24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F8XZ24
Domain Number 1 Region: 15-194
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.93e-33
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0021
Further Details:      
 
Domain Number 2 Region: 263-320
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000502
Family Ferredoxin domains from multidomain proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F8XZ24
Sequence length 326
Comment (tr|A0A0F8XZ24|A0A0F8XZ24_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:KKK47229.1} OX=412755 OS=marine sediment metagenome. GN=LCGC14_3157310 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MLTAEHVKEVLKEHCINLRFHARGGQGGITASNLCVEAYDGYGACQPLFGAERMGSPTES
YVRLSANEDLVRNNEQVYGPQFVCVLDPSLLGEIDVDAGIPPGGWLIVNTTMDQVSLQEV
VGRKDLNVATIDATNIAMDVLGRNITNTIILGALIRVSHLFSIENLSNAIMARFKGAIAG
KNIVAIKQATEDTCVYDIGVDVDFTVDSKVPWQQVSLGLPGYTELDMAGVWYKDETVIAV
GSDQVNTGSWGEWDIIWSGQKADGGKCTDCAQCWYICPDLAILTEKGEDGLQHMTGIDQF
HCKSCLNCISVCPVDAISKKLKQGPA
Download sequence
Identical sequences A0A0F8XZ24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]