SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F9EE46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F9EE46
Domain Number 1 Region: 3-169
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.01e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F9EE46
Sequence length 171
Comment (tr|A0A0F9EE46|A0A0F9EE46_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:KKL22243.1} OX=412755 OS=marine sediment metagenome. GN=LCGC14_2437380 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
VSEAAMIAGHDVKNNEIHGMAQRGGSVISQIRFGPQVYSPLIKKQSAHFVMSLEKLETLR
YLHLYNPETKMVVNDLKITPVTVTSGKSEYPGDIDKFLTENFQHVNIVDANRIAKDAGNI
KAVNVVIIGAMSNYLPFGDDIFEAAIRNSVKKNHVDLNIESFYRGKEAVNT
Download sequence
Identical sequences A0A0F9EE46

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]