SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F9GIK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F9GIK6
Domain Number 1 Region: 52-81
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00000144
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F9GIK6
Sequence length 84
Comment (tr|A0A0F9GIK6|A0A0F9GIK6_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:KKL98669.1} OX=412755 OS=marine sediment metagenome. GN=LCGC14_1822130 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MAEHKRGLEGSVSSGKTTKGGSGVGADNRKTAKFWLSHRQGPFMFHDNTKDCEQQPRDNV
SYLNDAAAAIEQGFMPCPRCMTGG
Download sequence
Identical sequences A0A0F9GIK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]