SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F9GZJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F9GZJ0
Domain Number 1 Region: 207-457
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.26e-59
Family PFOR Pyr module 0.063
Further Details:      
 
Domain Number 2 Region: 10-225
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.09e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.012
Further Details:      
 
Domain Number 3 Region: 466-575
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000377
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F9GZJ0
Sequence length 576
Comment (tr|A0A0F9GZJ0|A0A0F9GZJ0_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:KKL96111.1} OX=412755 OS=marine sediment metagenome. GN=LCGC14_1847750 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MDENKDRKDISIVLCGAAGQGIQTVEALLTKTLKRTGYNVFATREYMSRVRGGVNSTSIR
ISSKPVRGFLERIDLLIPLNKEALPHLKERISSETLILGEKQFIETTPEIETHTVEIPFT
ELSNAVGGSIYANIISLGVILCMLKAERTILYELLKENFSSKGQEIVNNNIKAADKGYEI
FEDLLNSSQISQRFEIEKNPEIVNDFILDGTQAIALGAIAGGCNFACFYPMAPSTGIGTF
LAQHALEFGMIVDQTEDEISAINKTLGASYAGARSFVSTSGGGFSLMTEGVSLAGMAEIP
IVMVVGQRPGPATGMPTRTCQEDIELVLHAGAGWFPRIIFSPGTIEDAFKLTQKAFNLTQ
KFHVPVFVLTDQYLVDSYYNIHSLDIDSLEIIKKIIRTDKNYERYCFTDSGISPRGIPGY
GEGLVDADSHTHDEFGVITEDPQLRIKAVEKRFKKLDLIRKETIPPEFIGSEDFKYLVVS
WGSNYYLIKEALERLERNDIGFLFFKQIYPIHESVFDYLIKAEIKISIEQNPTGQFAKLL
ENETHINMNHRILKFSGYVFSVEEIVERLKKIIEGN
Download sequence
Identical sequences A0A0F9GZJ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]