SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F9IK97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F9IK97
Domain Number 1 Region: 58-180
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 8.63e-36
Family Insert subdomain of RNA polymerase alpha subunit 0.0000776
Further Details:      
 
Domain Number 2 Region: 14-58,181-235
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 2.75e-31
Family RNA polymerase alpha subunit dimerisation domain 0.00069
Further Details:      
 
Domain Number 3 Region: 257-305
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 0.0000000000000144
Family C-terminal domain of RNA polymerase alpha subunit 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F9IK97
Sequence length 305
Comment (tr|A0A0F9IK97|A0A0F9IK97_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:KKL87697.1} OX=412755 OS=marine sediment metagenome. GN=LCGC14_1932150 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MSSNEHMYINWQEMIKPEKVQVTTKPAYGKFVCEPLERGFGITIGNALRRIILSSLYGAA
AVSVKFDTVMHEFSTIPGVLEDVSEIILNIKEVHFRLADLEPRTVRIDTEGEGELLAGEI
NSDDGKCEVLNPDLHIATLSEKTKLKMDINVKVGKGYLLSEANKDENAPIGTIPIDAVFS
PIKRVNYVVSNARVGQKTDYDKLTLEVWTDGSILPEDAVAYAAKILKEQMTIFINFDEAL
EPVPDKKPEESDKPQFNENLYRSVEELEFSVRSANCLKNADIFNIYQLVQKTESEMLKTK
NFGRK
Download sequence
Identical sequences A0A0F9IK97

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]