SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0F9N8L9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F9N8L9
Domain Number 1 Region: 153-336
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 9.29e-41
Family Methylesterase CheB, C-terminal domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0F9N8L9
Sequence length 350
Comment (tr|A0A0F9N8L9|A0A0F9N8L9_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:KKN15890.1} OX=412755 OS=marine sediment metagenome. GN=LCGC14_0981500 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MTGHRGRMHVGIVSDVVLQRHRLQAAAAKFGLEVCFSGDPHRLQDQPVLPDAGLWLVTLE
DEADHPALFDCLLENTDAPVLFGLDQAPAPGSAEYVRWERRLLGKLEQQLGELAQLDSQA
SLEQLAEQTPENAVSSELPHWLTPAAPDSVAEEIWVLCASLGGPAAVKAFLDHLPPGLPV
GFIYAQHIEGHFAEVLTRVLGRHAHYTLQHAEENYRVKNGDVVLMPVEHEWAFESTGVLT
ELDTPWPGPYGPCIDKVLLNTADRYGAQCHAILFSGMGNDGAIAAPLLKAYGSQIWVQES
TSCANSSMPDSVAATGCASFCGTPEQLAGELVKTIEKSCLLKGRQKRDTA
Download sequence
Identical sequences A0A0F9N8L9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]