SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F9PVE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F9PVE4
Domain Number 1 Region: 4-90
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000255
Family Group I mobile intron endonuclease 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0F9PVE4
Sequence length 146
Comment (tr|A0A0F9PVE4|A0A0F9PVE4_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:KKN34179.1} OX=412755 OS=marine sediment metagenome. GN=LCGC14_0796330 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MRKLTKVQAAYLAGMVDGEGCISILRARKATQGHSSVFRIVSTDKAVLDYLLEITGLGYV
RDYATSRNERNKNCKPQWGWQFSSVGMRELLPVILPYLITKREVAETALELLQSSLARGK
GVSSEEKARRAVLYERLKRLNHRGLS
Download sequence
Identical sequences A0A0F9PVE4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]