SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0F9UVU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0F9UVU5
Domain Number 1 Region: 8-145
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.0000000000000023
Family MJ1460-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0F9UVU5
Sequence length 181
Comment (tr|A0A0F9UVU5|A0A0F9UVU5_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:KKN97185.1} OX=412755 OS=marine sediment metagenome. GN=LCGC14_0158740 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MTKLAPALPIEVDSETGVWTSDALPMLYVPRHFFINNHVAVEEALGVEKYAEILYHAGYK
SAWHWCEKEAECHGLEGVDVFEHYMLRLSQRGWGLFITEQIDLDAGTARVRLEHSAFVYQ
LGKVGRKVEYMFTGWFAGAMDQILAARGSSLRTVAEQTQSAAEHGCDVGIFTVQPMTDTA
R
Download sequence
Identical sequences A0A0F9UVU5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]