SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G0A365 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0A365
Domain Number 1 Region: 425-668
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.45e-74
Family Capz alpha-1 subunit 0.0000129
Further Details:      
 
Domain Number 2 Region: 68-256
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.48e-63
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000427
Further Details:      
 
Domain Number 3 Region: 261-389
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.71e-33
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000852
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G0A365
Sequence length 677
Comment (tr|A0A0G0A365|A0A0G0A365_TRIHA) Transketolase {ECO:0000313|EMBL:KKP06777.1} KW=Complete proteome; Reference proteome OX=5544 OS=Trichoderma harzianum (Hypocrea lixii). GN=THAR02_01162 OC=Trichoderma.
Sequence
MKRQAVRHLKGALAHPRTPSAALNLARCYSTHPPNAKLNLPIDYSTTPLLAHTSAIAKQN
TEISSDVLHGATKKMNLFQAINDALNIALTEDETVSVFGEDVAFGGVFRCTMKLAETHGA
DRVFNTPLTEQGILGFAIGMAVEGMRPVAEIQFADYVFPAFDQIVNEAAKKRYYEGANGR
SAGGMTVRMPCGTVGHGALYHSQSPEALFTHVPGMRVIMPRSPLQAKGLLLAAIRSNDPC
IFMEPKILYRAAVEEVPVAPYELPLSKAEVIKEGKNVTIVSYGQPLYNCMAAIKQAEEDL
GISVELIDLRTIYPWDKKTVFESVQKTGRVLVVHESMVNAGVGAEVAAAIQENADTFNRL
EAPVSRVAGWSIHNALIFEKFHVPDVAKYVRPLHRAIVRLCTPLATGYGDQTAPRVDAPP
MLHLLAPTRLRYVIADIKALTASEPNIVDELAPAFEQYNEEQFITLKLPGSSQPVLISPH
NSLGGGRYYDVESSSSFEKASAVQSYVLEGSQADLVKSTLKSLGGYVKEHFPNAALGAYP
VESDSKVAVVVVANKYSPNNFWNGRWRSVYTFDPSSGNLEGTIMVDVHYYEDGNVRLLTN
KAVSASIPSGTGAGIVKEIASIEKKYQEDLNKSFVSLSEGAFKGLRRQLPVTRQKIEWDR
VTGYRLGQDIGGGSSKR
Download sequence
Identical sequences A0A0G0A365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]