SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G0BXD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0BXD4
Domain Number 1 Region: 204-454
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.75e-51
Family PFOR Pyr module 0.069
Further Details:      
 
Domain Number 2 Region: 5-227
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.4e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0094
Further Details:      
 
Domain Number 3 Region: 463-567
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000585
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G0BXD4
Sequence length 568
Comment (tr|A0A0G0BXD4|A0A0G0BXD4_9BACT) 2-oxoacid oxidoreductase gamma-subunit alpha, 2-oxoglutarate ferredoxin oxidoreductase subunit alpha {ECO:0000313|EMBL:KKP43575.1} KW=Complete proteome; Reference proteome OX=1619089 OS=candidate division WS6 bacterium GW2011_GWC1_33_20. GN=UR34_C0013G0010 OC=Bacteria; Candidatus Dojkabacteria.
Sequence
MDKRFAIKFSGQSGQGINTLGKLLSNAIKNSEYPIFATREYPSLIKGGFASYQIDVSSTQ
IFSSSKQCNILTSIAKDALNQYIGLVSKDGLILHSVKDFKLNAEDKEYILKNNIKYLFID
TEKIAQESNSPTIMANIVMLGAIWKVIGLDFKVLERVIRKYFSTKKNIDIEAEVRCLKAG
YNLELIKDIKIETFPTTKIKGWKKSKILTGNDALALGAISAGCRAYYAYPMTPATSILET
LGNTYMETGLIVKQAESEITAVQFAMGSMYMGTRAFTATSGGGFDLMTETISCCGMTETP
LVIVLGQRAGSGTGVPTWSGSSDLEVSLKGGHGEFPRCILATSDSEDSYELIQDAFNIAE
QYQIPVIVLSEKQIAESLFNIKTLPKPKKILRGLSNNGIERYKITKSGVSQRWIPQKGKK
TYLVNSDEHTQDGISTEDSKEITAMSSKRLRKLNTLLKNIPSPEYYGAVKPDIVFVGMGS
TKNAVIDAMKILNANIGYLHYKYIYPLRFERILQIHDKGTKIVLIENNQNGELGKLIREQ
SGLYIQDKLFKFDGRPFFVEDILEYLKK
Download sequence
Identical sequences A0A0G0ASI9 A0A0G0BXD4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]