SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0H5N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0H5N1
Domain Number 1 Region: 47-168
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 2.44e-35
Family Insert subdomain of RNA polymerase alpha subunit 0.0000835
Further Details:      
 
Domain Number 2 Region: 6-47,169-221
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 2.26e-28
Family RNA polymerase alpha subunit dimerisation domain 0.0025
Further Details:      
 
Domain Number 3 Region: 244-305
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 0.0000000000000115
Family C-terminal domain of RNA polymerase alpha subunit 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G0H5N1
Sequence length 307
Comment (tr|A0A0G0H5N1|A0A0G0H5N1_9BACT) Transcriptase subunit alpha {ECO:0000256|HAMAP-Rule:MF_00059} KW=Complete proteome OX=1618467 OS=Candidatus Levybacteria bacterium GW2011_GWC2_37_7. GN=US55_C0032G0006 OC=Bacteria; Candidatus Levybacteria.
Sequence
MVNPVFRVKEEKIAENHSEFTIEPLEPGYGHTLGNALRRTLLTSIPGAAVTSIKITGVKH
KFSTIPGVKENVVDLLLNIKGLNFRLLDSSEKGKASLSIKGSKEITGADFDLPENIEIVN
KDHYVASINDKKAKLEMELTIEQGFGYSSAEERRSTTLGLIPTDAVFTPVKRVSYDVSAT
RVGRQTDLDKLILSVWTNGIVSPKDVLVEASKILTAYFLQVYEPKPVTSPESISAKLSIA
DNVSKLTIDELDLPTRIYNSLRNGGIETLGQLLATTKKDLISMRNMGNKSIMIVEEKLKE
KSVSLAV
Download sequence
Identical sequences A0A0G0GIF9 A0A0G0H5N1 A0A0G0HSZ7 A0A0G0JAC1 A0A1F6KWB2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]