SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G0I643 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0I643
Domain Number 1 Region: 8-231
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.75e-36
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G0I643
Sequence length 271
Comment (tr|A0A0G0I643|A0A0G0I643_9BACT) 2-oxoglutarate ferredoxin oxidoreductase alpha subunit {ECO:0000313|EMBL:KKQ11561.1} KW=Complete proteome; Reference proteome OX=1619091 OS=candidate division WS6 bacterium GW2011_GWC2_36_7. GN=US24_C0023G0007 OC=Bacteria; Candidatus Dojkabacteria.
Sequence
MNMPTNRYCIKLGGESGQGINTLGILLSKAIKSLGYDIFSYREYPSLIKGGVASYQIDFS
NKYISSSSQNCNILTILDPEAVHEYLHSLNPNGILLYDDSKVEFSPEEQSWITQNQIHVI
YLDSEKIAVEAGGSSIMANIVMTSFLWKLLGFNPNDLANIVKEIFASKGEEIINKNILCL
NAGYNTSEFKEEYTQKTYIPNLPSEKKDSKILTGNDAIALGAISAGVRAYYGYPMTPATS
IFKYLGNTYKETGILIKQAESEITAVQRWGI
Download sequence
Identical sequences A0A0G0I643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]