SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G0PNN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0PNN4
Domain Number 1 Region: 1-221
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.53e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.01
Further Details:      
 
Domain Number 2 Region: 213-273
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.72e-16
Family Short-chain ferredoxins 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G0PNN4
Sequence length 275
Comment (tr|A0A0G0PNN4|A0A0G0PNN4_9BACT) 2-oxoglutarate ferredoxin oxidoreductase, gamma subunit {ECO:0000313|EMBL:KKQ90931.1} KW=Complete proteome; Reference proteome OX=1618332 OS=Berkelbacteria bacterium GW2011_GWA1_39_10. GN=UT15_C0002G0004 OC=Bacteria; Candidatus Berkelbacteria.
Sequence
MINILVAGEGGQGVQSIAKIINTSVDESSKESCYLPSFGVEQRGGVSLAFLRIDAKKILY
PRFDKADIIAALCSRSIDSIKDYIKDDTFLIYDGSIVENSVLDQIKPKVKKYINILANNI
AIKKYSVKSANMLMLGGVVAQLIDVNLSIIENNIKNEFKDKIAENPEIGTMNINAFHEGL
NIAKSFDQSSEELVGKPAHEIKTEYKDDKKSWIRFPEYCKGCGLCLVRCPVQALHFSKEV
GFLGNPLPEIDIDKCITCGQCEQICPDGAIKVEKS
Download sequence
Identical sequences A0A0G0NC47 A0A0G0PNN4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]