SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G0TF15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G0TF15
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 8.63e-26
Family Ribosomal L11/L12e N-terminal domain 0.00021
Further Details:      
 
Domain Number 2 Region: 67-139
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.22e-24
Family Ribosomal protein L11, C-terminal domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G0TF15
Sequence length 141
Comment (tr|A0A0G0TF15|A0A0G0TF15_9BACT) 50S ribosomal protein L11 {ECO:0000256|HAMAP-Rule:MF_00736, ECO:0000256|SAAS:SAAS00731162} KW=Complete proteome OX=1618903 OS=Parcubacteria group bacterium GW2011_GWC1_40_13. GN=UT80_C0032G0002 OC=Bacteria; unclassified Parcubacteria group.
Sequence
MAKKITKKLKLQIDGGKANAAPPIGPALGQAGVNIGDFVSKFNAATKDRMGEVVPVSITV
YEDRTFEFALKRPPATNLILKAIGVEKGSGKNAVKKAGSITKAQLKEIAKKKMSDLNAND
IEAAMKIIAGSARSMGVDVVG
Download sequence
Identical sequences A0A0G0RM74 A0A0G0TF15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]