SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G1BDI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1BDI8
Domain Number 1 Region: 220-470
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.26e-55
Family PFOR Pyr module 0.036
Further Details:      
 
Domain Number 2 Region: 29-225
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.75e-19
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.012
Further Details:      
 
Domain Number 3 Region: 482-588
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.22e-16
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G1BDI8
Sequence length 589
Comment (tr|A0A0G1BDI8|A0A0G1BDI8_9BACT) Pyruvate flavodoxin/ferredoxin oxidoreductase domain protein {ECO:0000313|EMBL:KKS35543.1} KW=Complete proteome; Reference proteome OX=1618944 OS=Parcubacteria group bacterium GW2011_GWD2_42_14. GN=UU98_C0032G0011 OC=Bacteria; unclassified Parcubacteria group.
Sequence
MLRVETECSFIYMTDSNTNSTGTHLAIKTIAIGGAAGDGVREAGINFSELFTELGYKTFS
SFDYPSLIRGGHNYARISYSVNTVYADYRELDVLIAVNAESVRVHQHSLRAGARVFVEEA
YLPEIADLGIAVIPLPMKKIAEELKAPQVARTSSAFGAYGYTLGIPLNQLKALADKVYAN
VGSEMNVALVEKGYAHMKKMQYPQDECAIPTEHGIVGEVTDGNKAIAKGFLAAGLEAYVG
YPMTPSTSTLQFLAKMSKKTGLKVVHPEDEIAVLNMALGMSYAGKRVAVGTANGGFALMQ
ETFSLAGVSEIPIAILVSMRMGPATGVATHTSQGDLQFILHAGHGEFPRLVIAPGDVEEC
FECAADALNLAWKYQIPAVVLSDKHLSESYKSVTLDTKSKGPDYGKRAVPVGTHYVRYKI
TEDGVSPLAFPGKANVVVKVTSYEHNEEGEAVESAEEVQAMQDKRFRKLNGLYQDFAWFP
TVKTYGDEWSDVVIVFWGSTKGAVLEAHKQLKTPAKLVQILWMEPFDADRVKAELNGARV
IVDVEANHTAQLAALIREKTSIEIHNKVLKYDAQPFTPTDLANEINKFL
Download sequence
Identical sequences A0A0G1BDI8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]