SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G1I3G3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1I3G3
Domain Number 1 Region: 3-207
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.31e-22
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G1I3G3
Sequence length 208
Comment (tr|A0A0G1I3G3|A0A0G1I3G3_9BACT) Pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein {ECO:0000313|EMBL:KKT53941.1} KW=Complete proteome; Reference proteome OX=1618930 OS=Parcubacteria group bacterium GW2011_GWC2_44_22. GN=UW45_C0022G0011 OC=Bacteria; unclassified Parcubacteria group.
Sequence
MGGEAGYGIMNTGGPIFAKTLMRAGFFVFIYSEYPSLIRGGHNTMQVTASESPCDAVYLA
LDQLVALNAHTIVAHQAEVKNGGVILYDSNLIKFSDDGRIDNSRIPTLTGSHTVAAGRAQ
TSRRPDIAYVPIPLEDIATQNGGDKIMRNVAAVGGSIAIFEQKVPGATGLLALADQILAD
IFKKKGEAVISANQKVLEAGYNEIKKLK
Download sequence
Identical sequences A0A0G1I3G3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]