SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G1KVJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1KVJ2
Domain Number 1 Region: 6-52
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000000000209
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G1KVJ2
Sequence length 53
Comment (tr|A0A0G1KVJ2|A0A0G1KVJ2_9BACT) Pyruvate ferredoxin oxidoreductase, gamma subunit {ECO:0000313|EMBL:KKT87598.1} KW=Complete proteome OX=1618700 OS=Candidatus Moranbacteria bacterium GW2011_GWC2_45_10. GN=UW87_C0029G0013 OC=Bacteria; Candidatus Moranbacteria.
Sequence
MKNKNSFEIIFFARGGQGAKTASELLAHAAVREGKFVKAFPHFGPERSGAPTK
Download sequence
Identical sequences A0A0G1KVJ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]