SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G1LIM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1LIM7
Domain Number 1 Region: 167-424
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.55e-65
Family PFOR Pyr module 0.029
Further Details:      
 
Domain Number 2 Region: 4-191
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.75e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.013
Further Details:      
 
Domain Number 3 Region: 436-539
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000011
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G1LIM7
Sequence length 540
Comment (tr|A0A0G1LIM7|A0A0G1LIM7_9BACT) Pyruvate flavodoxin/ferredoxin oxidoreductase domain protein {ECO:0000313|EMBL:KKT68722.1} KW=Complete proteome; Reference proteome OX=1619116 OS=candidate division WWE3 bacterium GW2011_GWB1_44_4. GN=UW65_C0036G0001 OC=Bacteria; candidate division WWE3.
Sequence
MAFLNWKIAGAAGEGIKVSGLMLQKTAFRTGLFTYGSTEYPSLIRGGHNTFEVVLSSEPV
QSARTKVDLLVDLKTSTIASLPFPLSDLAKGSGNLLTKNTVALGGSCALLALDLTILKQV
ITETFGSKDQSIIDQNHQAAQLGFDYALKNYPDKKLKLDTPKKPHQDKIMICGNEALALG
AVAGGMKFYCAYPMTPSTPILHYLAANAQKLNLVVNHAEDEIGVINMAIGAGFAGVRSMV
ATSGGGFSLMVEGLGLAGGTETPLVIILGMRPGPASGMPTWSGQGDLLFAINAAQDEFPR
IVLAPGDPEEAFDLAAKAQNLAEKYQLPVIILSDKNMGEGYYTSQRPPDKYKNRRYSLAP
EAAESDQPFKRYLVTDTGISPRPLPGQPGGVHLANSYEHDELGYATEISAERVKQMNKRL
KKLETILGSGDLIAPQLFGPKSAKTTLVSWGSNKGAIVDALPQLPDINYLHFSWMWPFPE
KQFKALISHNPRLVTIEGNATAQLAKLIAQQTGIIIKDKILKYDGRRFYPEEIIEAVKKL
Download sequence
Identical sequences A0A0G1LIM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]