SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1NQL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1NQL1
Domain Number 1 Region: 2-71
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 7.19e-28
Family Ribosomal L11/L12e N-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 67-139
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 5.1e-27
Family Ribosomal protein L11, C-terminal domain 0.0000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G1NQL1
Sequence length 139
Comment (tr|A0A0G1NQL1|A0A0G1NQL1_9BACT) 50S ribosomal protein L11 {ECO:0000256|HAMAP-Rule:MF_00736, ECO:0000256|SAAS:SAAS00731162} KW=Complete proteome; Reference proteome OX=1618619 OS=Candidatus Azambacteria bacterium GW2011_GWC1_46_13. GN=UX33_C0007G0023 OC=Bacteria; Candidatus Azambacteria.
Sequence
MKPIKTIIKLQIEAGKATPAPPVGPALGQHGLNIQQFCTQFNEATKAQSGDIIPVEITVF
EDRTYQFILKTPPASDLLRKAAGIDKGSAQPNRNKVGKVSREKIKEIAEKKMADLNAHDL
EAAEKIIMGTARSMGITIE
Download sequence
Identical sequences A0A0G1NQL1 A0A0G1Q2Y2 A0A0G1QMT5 A0A0G1SEW9 A0A1F5BX96 A0A1F5C615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]