SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G1TC08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G1TC08
Domain Number 1 Region: 2-118
Classification Level Classification E-value
Superfamily YerB-like 8.76e-25
Family YerB-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G1TC08
Sequence length 120
Comment (tr|A0A0G1TC08|A0A0G1TC08_9BACT) PEGA domain protein {ECO:0000313|EMBL:KKU42960.1} KW=Complete proteome; Reference proteome OX=1618335 OS=Berkelbacteria bacterium GW2011_GWA2_46_7. GN=UX60_C0042G0010 OC=Bacteria; Candidatus Berkelbacteria.
Sequence
MTWTHDPVTNTYNRVLNGTAHKDRVSGEQIIAKTVVVMTVNHSANAPYAGTGKESEWTMT
TVGSGATSVFEDGTRTDGTWKKPSRLERTRFYDGQGAEIPLNRGKIWIEVLPQDGSISTT
Download sequence
Identical sequences A0A0G1TC08

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]