SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G2EDM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2EDM0
Domain Number 1 Region: 339-539
Classification Level Classification E-value
Superfamily MIR domain 5.75e-57
Family MIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 909-1021
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.82e-36
Family Calponin-homology domain, CH-domain 0.000029
Further Details:      
 
Domain Number 3 Region: 1073-1140
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000000000248
Family EB1 dimerisation domain-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G2EDM0
Sequence length 1157
Comment (tr|A0A0G2EDM0|A0A0G2EDM0_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KKY21002.1} KW=Complete proteome; Reference proteome OX=158046 OS=Phaeomoniella chlamydospora. GN=UCRPC4_g03919 OC=Phaeomoniellales incertae sedis; Phaeomoniella.
Sequence
MASTVHEVDGKRTTRSSKSPRPSRNLRSEAVERKPTKKADYGSEGVTDNDILLLPGSDYS
ILAAVTIIAAAVRIFRIYQPTSVVFDEVHFGGFASKYIKGKFFMDVHPPLAKMLIALVGW
LAGFDGDFDFKEIGKDYIEPKVPYVAMRLLPAILGVLTIPTMFLTLKAYGCRTMTAVLGA
GLLIFENALVTQSRLILLDSPLIFCTAFTALAFTCFTNQHEQGPSRAFDPTWWFWLVMTG
LGLGATVSIKWVGLFTIAWVGSLTVLQLWVLLGDTNTVTPRLWFKHFFARMFCLIIIPVA
FYVGMFAIHFVCLVNPGDGDGFMSSEFQATLNSKGMQAVPADVAFGSTVSIRHHNTQGGY
LHSHPSMYPGGSNQQQITLYPHKDDNNLWLLENQTQPVDALNVTIPGPQAWSNLPTEWIR
DGDILKLYHTPTHRRLHSHDVRPPVTEADWQNEVSAYGYEGFEGDANDLFRVEIIRSMSD
GAVAKQRLRTIETKFKLVHVMSGCVLFSHKVKLPDWGYEQQEVTCARGGTLPNSVWYVES
NEHPMLGEDAEKVNYRDPGFLGKFWELQQVMWTTNAGLVESHTWDSRPPSWPVLRRGINF
WGKDHHQIYLLGNPAIWWASTAAIAIYVFFKGLSVLRWQRGYRDYDNTNFKRFDYEIGMT
VIGWAFHYFPFFLMARQLFLHHYLPALYFAIMAMCQIYDFGANRIATLGIRNHPEIGRTI
AVLYLAFCIAVFTMYAPLIYGNKWTQNECKSVKLFETWDFDCNTFLMDYSHYAEDGLIDA
GKVQKTPKVAPAKDEKPAQQVIQQEQKEDEGKVTPQPSLEQKIIGREQKVEYRDENGNIL
DDEQVSSLAAEGKVTFKTKYETRTRLVDEAGKEVYDEIAPQHPDVEGQNPDTKGVPEDQA
RVAEFSVLLQELLAWLNSLLQLNITKVEQCGTGAAYCQVFDSIYMDVPMSRVKFNVNTEY
AYIQNFKVLQNVFTRHGIDRMVPVESLVKCKMQDNLDFLQFTKRYWDQYFPGHDYDAVAR
RKNAPASAAPAAGGRVSAGAGARKPGVTSAVKPRVGSAAGGAVVGGASGAAVARLKEENA
GLQEAITGLERERDFYFSKLRDIELLIQQAIEADPEIEKDDNSILKHIQSILYSTEEGFE
IPAEGEGELAADEAETF
Download sequence
Identical sequences A0A0G2EDM0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]