SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2GUC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2GUC8
Domain Number 1 Region: 55-105
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 2.28e-19
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00071
Further Details:      
 
Domain Number 2 Region: 5-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000173
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G2GUC8
Sequence length 110
Comment (tr|A0A0G2GUC8|A0A0G2GUC8_9PEZI) Transcription initiation factor IIA subunit 2 {ECO:0000256|PIRNR:PIRNR009415} KW=Complete proteome; Reference proteome OX=420778 OS=Diplodia seriata. GN=UCDDS831_g01137 OC=Botryosphaeriaceae; Diplodia.
Sequence
MSDLNYYEIYRKTSIGLTLMDTLDELISTRRMEPQLAIKIMQNFDKALADVISEKVKARM
SFKGHLDTYRFCDDVWTFIIKDITFKMDNSQSLTADKIKIVSNNSSRPGN
Download sequence
Identical sequences A0A0G2GUC8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]