SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0G2K5J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2K5J1
Domain Number 1 Region: 217-394
Classification Level Classification E-value
Superfamily MIR domain 9.68e-47
Family MIR domain 0.0024
Further Details:      
 
Domain Number 2 Region: 1081-1208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-18
Family SPRY domain 0.041
Further Details:      
 
Domain Number 3 Region: 660-811
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000396
Family SPRY domain 0.063
Further Details:      
 
Domain Number 4 Region: 440-552
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000745
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 5 Region: 103-187
Classification Level Classification E-value
Superfamily MIR domain 0.00000863
Family MIR domain 0.028
Further Details:      
 
Domain Number 6 Region: 2196-2266
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000124
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Domain Number 7 Region: 1434-1558
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000261
Family SPRY domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G2K5J1
Sequence length 5012
Comment (tr|A0A0G2K5J1|A0A0G2K5J1_RAT) Ryanodine receptor 1 {ECO:0000313|Ensembl:ENSRNOP00000073446} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Ryr1 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MGDGGGEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVP
PDLAICCFILEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLS
CLTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERY
LHLSTASGELQVDASFMQTLWNMNPICSCCEEGFVTGGHVLRLFHGHMDECLTISPSDSD
DQRRLVYYEGGPVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLALTEDQGL
VVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTY
AAPDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKGLD
SFSGKPRGSGPPAGSALPIEGVILSLQDLIGYFEPPSEELQHEEKQTKLRSLRNRQSLFQ
EEGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCAL
FSTNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKV
LDVLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGSTQY
GKWYFEVMVDEVAPFLTAQATHLRVGWALSEGYSPYPGGGEGWGGNGVGDDLYSYGFDGL
HLWTGHVARPVTSPGQHLLGPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFP
VVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLQPIKEYRREGPRGPHL
VGPSRCLSHLDFVPCPVDTIQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDD
NKRLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTY
MMNNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNP
RLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVDSQSRGDRARIFRAEK
SYAVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADDLAYVFNGHRGQRWHLGSEPF
GRPWQSGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFREIEIGDGFLPVCSLGPGQV
GHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEPVPLEHPHYEVAR
MDGTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLASPGLQPPA
EDEARAAEPDTDYENLRRSAGGWGEAEAGKDGTAKEGTPGGAAQPGVEAQPARAENEKDA
TTEKNKKRGFLFKAKKVAMMTQPPSTPALPRLPRDVVPADNRDDPEIILNTTTYYYSVRV
FAGQEPSCVWVGWVTPDYHQHDMSFDLSKVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGD
FVSPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQ
NVVQFDLRPGANIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLHVDTRR
AGERLGWAVQCQEPLMMMALHIPEENSEPYIHLKRAQLDPRDLRDYRDTKFDSESSDSDQ
TPQPGCYHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTE
ETRAITLFPPGRSAEDGPRRHGLPGVGVTTSLRPPHHFSPPCFVVALPAAGAAEAPARLS
PAIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGVFSDEDV
KQILKMIEPEVFTEEEEVEEEEEEEEEDEEEKEEDEEEEAHEKEDEEKEEAEEAAEEEKE
ELEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQSNQRGRYGLL
MKAFTMSAAETARRTREFRSPPQEQINMLLQFKNGADEEDCPLPEEIREDLVNFHQDLLA
HCGIQLEGEEEEPEEESTLGSRLMSLLEKVRLVKKKEEKPEEEPAAEEHKPQSLQELVSH
TVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISLSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGES
KEIRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASV
IDNNELALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGVRRD
RRREHFGEEPPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSL
VPLDDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSRRWALALNRYLCLAVLPLITKCAPLLRGTEHRAIMVDS
MLHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPL
KLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDQELYRIAMP
CLCAIAGALPPDYVDASYSSKTEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEY
AHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEW
TVEKAREGEEEKTEKKKTRKISQTAQTYDPREGYNPQPPDLSVVTLSRELQAMAEQLAEN
YHNTWGRKKKQELEAKGGGSHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRHG
KDMELDTSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKI
LLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDA
PAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQ
VKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTRNP
YVEKLRPALGECLARLAAAMPVAFLEPELNEYNACSVYTTKSPRERAILGLPNSVEEMCP
DIPVLERLMAEIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPALPAGAP
PPCTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLRSHFIPT
IGRLRKRAGKVVAEEEQLRLEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRYVDNNRS
AWPRLPPSPSSSFSLPSPSELGRWLMKDHGHQLYEESFTVPLILDNAAFPLARNQSRAIG
CAGVVRSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLIVLAKAR
YALKDTDEEVREFLQNNLNLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEV
SAVLYHLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKA
SWILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDED
YLYMAYADIMAKSCHLEEGGENVEEGGEEEEVEVSFEEKEMEKQRLLYQQSRLHNRGAAE
MVLQMISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQ
TCRWPHKTLSQREGQEERVMKVQTSGTLVIINRQNGEKVMADDEFTQDLFRFLQLLCEGH
NNANLQSLLFPAMTSLAVQTLSSLSLYLTLFSEEAQCVRPFYHPERHETLSQRNNSNKFL
WLLKFLEANRLCSLSLWPVPLPKGSLPKSSLARSHLPQMGNWSHSVFPRALVSALQRINA
RVHRRTNCLVFKKNISQEMYRSSLSRRENFHRLCLHCANLAKIHPLIKHPVRLKQLTLRD
SLQSRCSDRRRRSRGRRRGRRSPSRLAAQPGQPSLRAVSHDKRVTWLRLQCSQYTECHKP
PRGKVGFSVSMTLYNVCDCVTIRCVVCDCGNHEAVWDCVTVDDGVGLVVSCEHVMCVTAM
SSDVVVSLYSHVVVTRVSVTMAAVDCDAARSVTVAVCDLRWVVTVAVWTCDECDCDGRAD
CGVCDVVWAGPLTAWCVLSWSVCDCGVCDCGVVWLCGCARVVTVVVVCVCGVSDLWSLLR
DCIGGKAPGGFQGLIWGPTVPGFYSQKAGPQYLGKPVTEEPPSLEGQPGPYIANLRQAML
SRYYVEGVGRFSSSAGPWRSAVLPPGGGGAGRSAGGGEDTMIERKAAMGMVMNTFNPSTQ
KTETGLEEMAQWLRTPDYSSRGPEFNSQQPHGGSHPSVMGSDALFLVKTETDGFSLSFRS
SLDYTVVFRSARAVHSENPVSKREKQGRRARKQKESHINAPLLVPLSDLPLTSFQVSDSP
PGEDDIEGSGAGDMFRGSGLVIGSGWGSRASEEVEGDEDENMVYYFLEGGTGYMEPALRC
LSLLHTRWPFSCIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDDDVKGQWDRLV
LNTPSFPSNYWDKFVKRKVLDKHGDIFGRERIAELLGMDLASLEITAHNERKPDPPPGLL
TWIMSIDVKYQIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFAAHLLDIAMGVKTLRT
ILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLF
HMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRD
QQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTG
QESYVWKMYQERCWDFFPAGDCFRKQYEDQLG
Download sequence
Identical sequences A0A0G2K5J1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]