SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2QXR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2QXR1
Domain Number 1 Region: 1-37
Classification Level Classification E-value
Superfamily Ribosomal protein L36 1.32e-16
Family Ribosomal protein L36 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G2QXR1
Sequence length 37
Comment (tr|A0A0G2QXR1|A0A0G2QXR1_9CARY) 50S ribosomal protein L36, chloroplastic {ECO:0000256|HAMAP-Rule:MF_00251} OX=179119 OS=Salicornia brachiata. GN=rpl36 OC=Salicornia.
Sequence
MKIRASVRPICEKCRLIRRRGRIIVICSNPKHKQRQG
Download sequence
Identical sequences A0A0G2QXF5 A0A0G2QXM4 A0A0G2QXR1 A0A0K0K888 A0A0K0K8H2 A0A165XMS6 P12230
001936511|e5mlc61|919.1.1.1|6:1-37 001943597|e5mmm51|919.1.1.1|5:1-37 001945622|e5mmi51|919.1.1.1|5:1-37 001954373|e5h1sf1|919.1.1.1|f:1-37 002081605|e5x8t51|919.1.1.1|5:1-37 002083787|e5x8p51|919.1.1.1|5:1-37 5h1s_f 5mlc_6 5mmi_5 5mmm_5 5x8p_5 5x8t_5 6eri_Ae

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]