SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2T3W4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2T3W4
Domain Number 1 Region: 9-159
Classification Level Classification E-value
Superfamily UraD-Like 8.89e-36
Family UraD-like 0.00000738
Further Details:      
 
Domain Number 2 Region: 208-332
Classification Level Classification E-value
Superfamily Transthyretin (synonym: prealbumin) 2.88e-30
Family Transthyretin (synonym: prealbumin) 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G2T3W4
Sequence length 332
Comment (tr|A0A0G2T3W4|A0A0G2T3W4_9ROSI) Transthyretin-like S-allantoin synthase protein {ECO:0000313|EMBL:AKF43393.1} OX=28968 OS=Pelargonium cotyledonis. GN=TF OC=Pentapetalae; rosids; malvids; Geraniales; Geraniaceae; Pelargonium.
Sequence
MGFDEKDFLACCGSSKFAMEMASASPFNTLDHAITTARDIWFNKVDVKGWLEAFEAHPQI
GKSPSPNHNSETFAQWSKGEQTTALATATRSSLLELSVWNAKYMQKFGFVFLICAFGRST
SEILTELKKRYPNRPIVEFENAAQEQMKITELRLAKLFSTKAESASTHDQQPMALKKKAE
EDRVSIIGAHLTAPSQEPADKTSQISSRTRPPITTHVLDVSRGSPAVGMDVKLEMWMNEQ
SRPSFDKTDIGGWVMQGFSTTDKDGRSGQLMSIVDSVNPGIYRISFNTGNYCPGGFFPYV
SLVFEIRETQKSEHFHVPLLFSPFSFTTYRGS
Download sequence
Identical sequences A0A0G2T3W4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]