SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2U4V5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2U4V5
Domain Number 1 Region: 47-111
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 0.0000000000017
Family Interleukin 8-like chemokines 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G2U4V5
Sequence length 159
Comment (tr|A0A0G2U4V5|A0A0G2U4V5_HCMV) Chemokine vCXCL2 {ECO:0000313|EMBL:AKI18365.1} KW=Complete proteome OX=10359 OS=Human cytomegalovirus (HHV-5) (Human herpesvirus 5). GN=UL147 OC=Betaherpesvirinae; Cytomegalovirus. OH=9606
Sequence
MMLRRLHHPILNPHTNILSVRYMQLTAYMLFAVCPLAVHLLELEDYDRRCRCNNQILLNT
LPVGTELLKPIAASESCNRQEVLAILKDKGTKCLNPNAQAVRRHINRLFFRLILDEEQRI
YDVVSTNIEFGAWPVPTAYKAFLWKYAKRLNYHHFRLRW
Download sequence
Identical sequences A0A0G2U4V5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]